PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA9G00041
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family MYB
Protein Properties Length: 324aa    MW: 37046.5 Da    PI: 8.5732
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA9G00041genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding513.4e-1660105147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg W + Ed +l+++v+ +G+ +W+ Ia++m+ gRt+k+c++rw++ 
        AA9G00041  60 RGHWKPSEDFKLKELVAIFGPQNWNCIAEKMQ-GRTGKSCRLRWFNQ 105
                      899*****************************.***********996 PP

2Myb_DNA-binding49.68.9e-16113156247
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       +++ eE+e+l+ a++ +G++ W+ Ia+ +  gRt++ +k++w+ +
        AA9G00041 113 RAFSDEEEERLLAAHRAFGNK-WAMIAKLFH-GRTDNAVKNHWHVL 156
                      689******************.*********.***********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.85355106IPR017930Myb domain
SMARTSM007172.6E-1259108IPR001005SANT/Myb domain
PfamPF002492.5E-1560105IPR001005SANT/Myb domain
SuperFamilySSF466894.39E-2760157IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.8E-2561113IPR009057Homeodomain-like
CDDcd001677.00E-1163104No hitNo description
PROSITE profilePS5129424.143107161IPR017930Myb domain
SMARTSM007175.7E-13111159IPR001005SANT/Myb domain
PfamPF002491.4E-12113156IPR001005SANT/Myb domain
CDDcd001676.91E-9114157No hitNo description
Gene3DG3DSA:1.10.10.602.4E-20114160IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MDFSCFQKHP CDDSNCRVPF NGFGENNALL GETCTKLRMH KVSEQERKKK KHNLSKLCSR  60
GHWKPSEDFK LKELVAIFGP QNWNCIAEKM QGRTGKSCRL RWFNQLDPRI NKRAFSDEEE  120
ERLLAAHRAF GNKWAMIAKL FHGRTDNAVK NHWHVLMARK FRQQSTSYTR RHSPSPHKPS  180
INDETEAEGN TCFTDEILTS LNPQTFNLFP GKVGDEDENL KKYSWKMLKE GSTNLKAEYH  240
QEEYFSRMPM HYSSHHHHSS TFPGDSLALL TPHVSVSNPS SSPSLSSSSL SSSSSSEEEN  300
TVVARYFETN IPPTFIDFLG VGAS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-29601617108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF2727325e-82AF272732.1 Arabidopsis thaliana putative transcription factor (MYB110) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002877150.11e-126MYB110
TrEMBLA0A087GAL31e-128A0A087GAL3_ARAAL; Uncharacterized protein
STRINGscaffold_500894.11e-125(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63001846
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G29020.21e-110myb domain protein 110